10990 kaashiiraameishvarayaatradarpand-amu
Paperback
ISBN13: 9781149211212
Publisher: Nabu Press
Published: May 11 2010
Pages: 152
Weight: 0.49
Height: 0.33 Width: 6.14 Depth: 9.21
Language: Telugu
10990 kaashiiraameishvarayaatradarpand-amu is a Telugu travelogue documenting a pilgrimage to Kaashi (Varanasi), a city of immense religious significance in Hinduism. Written by subramand-yan'pan'd'itulu subramand-yan'pan'd'itulu and published in 1917, the book provides a historical snapshot of travel conditions and religious practices of the time. This text offers insights into the experiences of pilgrims, the sacred sites visited, and the cultural context of early 20th-century India. A valuable resource for those interested in Hindu pilgrimage traditions and the history of travel in India.
This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work was reproduced from the original artifact, and remains as true to the original work as possible. Therefore, you will see the original copyright references, library stamps (as most of these works have been housed in our most important libraries around the world), and other notations in the work.
This work is in the public domain in the United States of America, and possibly other nations. Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.
As a reproduction of a historical artifact, this work may contain missing or blurred pages, poor pictures, errant marks, etc. Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public. We appreciate your support of the preservation process, and thank you for being an important part of keeping this knowledge alive and relevant.
Also in
India & South Asia
Lonely Planet India: Plan the Trip of a Lifetime Detailed Itineraries & Maps Insider Tips Covers Delhi, Rajasthan, Punjab, Ladakh, Agra, Kerala, Kolka
Bigg, Margot
Bindloss, Joe
Noble, Isabella
Paperback
Lonely Planet Sri Lanka: Plan the Trip of a Lifetime Detailed Itineraries & Maps Insider Tips Covers Colombo, the West Coast, the Ancient Cities, Mann
Choy, Monique
Kaminski, Anna
Mayhew, Bradley
Paperback
Rough Guides Nepal: Travel Guide with eBook: 2026-2027 Insider Tips Must-See Sights Maps & Itineraries Covers: Kathmandu, Pokhara, Chitwan and More
Guides, Rough
Nelson, Matthew
Warwicker, Siobhan
Paperback
Lonely Planet Nepal: Plan the Trip of a Lifetime Detailed Itineraries & Maps Insider Tips Covers Kathmandu, Himalayas, Trekking and More
Mayhew, Bradley
Bindloss, Joe
Fegent-Brown, Lindsay
Paperback
Patterns of India: A Journey Through Colors, Textiles, and the Vibrancy of Rajasthan
Chitnis, Christine
Hardcover
Lonely Planet India: Plan the Trip of a Lifetime Detailed Itineraries & Maps Insider Tips Covers Delhi, Goa, Kerala, Rajasthan, Agra, Mumbai and More
Bigg, Margot
Bindloss, Joe
Choy, Monique
Paperback
Chaat: Recipes from the Kitchens, Markets, and Railways of India: A Cookbook
Eddy, Jody
Chauhan, Maneet
Hardcover
India - Culture Smart!: The Essential Guide to Customs & Culture
Stephen, Becky
Culture Smart!
Paperback
Lonely Planet Experience India: Build a Trip to Remember Local Insights Maps & Planning Tools Covers Delhi, Rajasthan, Punjab, Haryana, Kolkata, Keral
Bigg, Margot
Bindloss, Joe
Lobo, Christabel
Paperback
The Kerala Kitchen, Expanded Edition: Recipes and Recollections from the Syrian Christians of South India
George, Lathika
Paperback
The World Spins By: A Gift of Time, Love, and the Long Bike Ride Back to Myself
Kopack, Jerry
Paperback
Lonely Planet Sri Lanka: Plan the Trip of a Lifetime Detailed Itineraries & Maps Insider Tips Covers Colombo, the South, the Hill Country, the Ancient
Francis, Joseph Richard
Paska, Marisa Megan
Mayhew, Bradley
Paperback
Lonely Planet Experience Sri Lanka: Build a Trip to Remember Local Insights Maps & Planning Tools Covers Colombo, the Hill Country, the Ancient Cities
Choy, Monique
Kaminski, Anna
Rathnayake, Zinara
Paperback
Ascent of the Thunder Dragon: The Surprising Spiritual Life and Legacy of Bhutan's Founder
Wakefield, Sasha
Paperback
Lonely Planet Rajasthan, Delhi & Agra: Plan the Trip of a Lifetime Detailed Itineraries & Maps Insider Tips Covers Taj Mahal, Jaipur, Udaipur, Agra Fo
Choy, Monique
Bindloss, Joe
Sidhu, Puneetinder Kaur
Paperback
Lonely Planet Bhutan: Plan the Trip of a Lifetime Detailed Itineraries & Maps Insider Tips Covers Thimphu, Paro, Trongsa and Mongar Dzongkhag and More
Fegent-Brown, Lindsay
Tenzin, Galey
Mayhew, Bradley
Paperback
Tuttle Pocket Hindi Dictionary: Hindi-English English-Hindi (Fully Romanized)
Delacy, Richard
Paperback
Ancient Secrets of a Master Healer: A Western Skeptic, An Eastern Master, And Life's Greatest Secrets
Rogers, Clint G.
Paperback
Decoded Durga Saptashati in Sanskrit and English: It gives you strength, great mental balance, bliss and success
Thorat, Santosh
Hardcover
Lonely Planet South India & Kerala: Plan the Trip of a Lifetime Detailed Itineraries & Maps Insider Tips Covers Mumbai (Bombay), Maharashtra, Goa, Kar
Bindloss, Joe
Grace, Lucie
Lobo, Christabel
Paperback
The Jackfruit Chronicles: Memories and Recipes from a British-Bangladeshi Kitchen
Ahsan, Shahnaz
Hardcover
Trekking Everest Base Camp: Classic Ebc, Three Passes & Gokyo Lakes
McCluggage, Andrew
Butler, Stuart
Paperback
Oude geheimen van een Meester-Genezer: Een Westerse Scepticus, een Oosterse meester en de Grootste
Rogers, Clint G.
Paperback
21 Days to Paradise: Reader's Edition: Journey to the Roof of the Universe
Ventrone, Sebastian Theodore
Paperback
Maldives Traveler's Guide 2026: Your Guide to Islands, Resorts, Local Culture, and Budget-Smart Travel
Lyde, John
Paperback
River Traveller - Journeys on the Tsangpo-Brahmaputra from Tibet to the Bay of Bengal
Hazarika, Sanjoy
Paperback
Overland Before the Hippie Trail: Kathmandu and Beyond with a Van a Man and No Plan
Sullivan, Patricia Noble
Paperback
20 Hindi Short Stories for Beginners: An English-Hindi Dual-Language Book for Easy Reading and Learning
Mengioglu, Duygu
Paperback
Beyond the Snow Leopard: Travels Through the Himalayas, Buddhism, Mountaineering and Possible Paths to Enlightenment
Crozier, Bill
Paperback
Trekking in the Karakoram: Pakistan: K2, Snow Lake, Gondogoro La and Nanga Parbat
Jordans, Bart
Paperback
My Journey to Lhasa: The Classic Story of the Only Western Woman Who Succeeded in Entering the Forbidden City
David-Neel, Alexandra
Hardcover
Discovering Bhutan: Land of Gross National Happiness
Schofield, Janet Ward
Schofield, Janetward
Paperback
Secrets ancestraux d'un maître guérisseur: Un sceptique occidental, un maître oriental et les plus grands secrets de la vie
Rogers, Clint G.
Paperback
Butter Chicken in Ludhiana: Travels in Small Town India: Now with a New Introduction by Chandrahas Choudhury
Mishra, Pankaj
Paperback
DK Top 10 Delhi: Top 10 Lists for Your Perfect Trip, Plus an All-Weather Folded Map
Dk Travel
Paperback
Greater Than a Tourist - Bologna, Emilia-Romagna Region, Italy: 50 Travel Tips from a Local
Mathews, Emily
Tourist, Greater Than a.
Paperback
Secretos Ancestrales de un Maestro Sanador: Un escéptico occidental, Un maestro oriental, Y los mayores secretos de la vida
Rogers, Clint G.
Paperback
Mystic Journey to India: The Key to Spiritual Awakening and Fixing Fate
Hamilton-Parker, Craig
Paperback
Adventure in Zanskar: A young woman's solitary journey to reach physical and metaphysical heights
Edelstein, Amy
Paperback
The Long Strider in Jehangir's Hindustan: In the Footsteps of the Englishman Who Walked From England to India in the Year 1613
Srivatsa, Sarayu
Moraes, Dom
Paperback
101 Great and Unique Things about India: Book #12 of the "GREAT NATIONS" series
James, Andrew
Paperback
पहाड़ी बघल्याणी १
Kaviraaj, Shyaam Laal Gautam
Paperback
Annapurna Base Camp Hiking Guide 2026: Discover the Annapurna Region, Nepal: Villages, Trails, and Base Camp Trekking
Bennett, Scarlett
Paperback
One Year and a One-Way Ticket: Ditching My Mother's Five-Year Plan to Travel Solo
Smith, Danika
Paperback
Keeping the Dalai Lama Waiting & Other Stories: An English Woman's Journey to Becoming a Buddhist Lama
Hookham, Lama Shenpen
Paperback
Rough Guides India: Travel Guide with eBook: 2027 Insider Tips Must-See Sights Maps & Itineraries Covers: Delhi, Rajasthan, Goa, Mumbai and More
Edwards, Nick
Binayak, Poonam
Guides, Rough
Paperback
Rough Guides South India and Kerala: Travel Guide with eBook: 2026-2027 Insider Tips Must-See Sights Maps & Itineraries Covers: Kerala, Chennai, Benga
Guides, Rough
Narayan, Rashmi
Paperback
Greater Than a Tourist - The Garden Route Western Cape Province South Africa: 50 Travel Tips from a Local
Tourist, Greater Than a.
McGregor Van Aardt, Li-Anne
Paperback
Volga Se Ganga (वोल्गा से गंगा)
Rahul Sankrityayan
Paperback
رأيت في الهند: يوميات كات
خدوسي, راب&#
Paperback
Learn Nepali While Having Fun! - For Children: Kids of All Ages - Study 100 Essential Thematics with Word Search Puzzles - Vol.1
Linguas Classics
Paperback
Learn Bengali While Having Fun! - For Adults: Easy to Advanced - Study 100 Essential Thematics with Word Search Puzzles - Vol.1
Linguas Classics
Paperback
Learn Telugu While Having Fun! - For Children: Kids of All Ages - Study 100 Essential Thematics with Word Search Puzzles - Vol.1
Linguas Classics
Paperback
Learn Urdu While Having Fun! - For Children: Kids of All Ages - Study 100 Essential Thematics with Word Search Puzzles - Vol.1
Linguas Classics
Paperback
El-Akar Akash (এল-আকার আকাশ): A Collection of Bengali Poems
Chakraborty, Sujit
Paperback
Tiger in a Lifeboat: Discovering India, Deconstructing Faith, and Deciding to Trust Again
Cibene, Lauren
Paperback
A Voyage to the East-Indies: Giving an Account of the Isles of Madagascar, and Mascareigne, of Suratte, the Coast of Malabar, of Goa, Gameron, Ormu
Dellon, Gabriel
Crull, Jodocus
Paperback
